PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA01G0174500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB_related
Protein Properties Length: 300aa    MW: 31131.6 Da    PI: 7.6357
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA01G0174500.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81.1e-12136180347
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        +W++eE+ l++ +  +lG+g+W+ I+r   ++Rt+ q+ s+ qk+
  ORGLA01G0174500.1 136 PWSEEEHRLFLVGLDKLGKGDWRGISRSYVTTRTPTQVASHAQKF 180
                        8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.532318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.374129185IPR017930Myb domain
SuperFamilySSF466891.01E-16130186IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-17132184IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-9133176IPR009057Homeodomain-like
SMARTSM007176.0E-9133183IPR001005SANT/Myb domain
PfamPF002495.4E-10136179IPR001005SANT/Myb domain
CDDcd001671.54E-8136181No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MARKCSHCGN YGHNSRTCSS SSASAGHRDT TMLCDGGDGG GGGGLRLFGV QVHVAAGGGG  60
GGGGGGGLSM KKSYSMDCLQ LAAAGAAPGS LVSPSSSSSS SMLLSIDEGG LERASNGYLS  120
DGPHGRIVQE RKKGVPWSEE EHRLFLVGLD KLGKGDWRGI SRSYVTTRTP TQVASHAQKF  180
FLRQSSIGKK KRRSSLFDMV PICENGARVS EQLSGEGAAA ASTSLSLMNT HETSSDRVAA  240
IDLNSTEEDD TVGASGRPFF PVVLMEQQQQ ASHGHGHHHH CTPLDLELGM SVSSTPSIGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1188192KKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8342880.0CT834288.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA105A23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648805.11e-171PREDICTED: uncharacterized protein LOC4324094
TrEMBLA0A0D3EQZ10.0A0A0D3EQZ1_9ORYZ; Uncharacterized protein
TrEMBLI1NPF50.0I1NPF5_ORYGL; Uncharacterized protein
STRINGORGLA01G0174500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-44MYB_related family protein